General Information

  • ID:  hor002776
  • Uniprot ID:  P69897
  • Protein name:  Tubulin beta-2C chain168-185
  • Gene name:  Tubb5
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Tubulin family
  • Source:  Animal
  • Expression:  Ubiquitously expressed with highest levels in spleen, thymus and immature brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0000166 nucleotide binding; GO:0003924 GTPase activity; GO:0005200 structural constituent of cytoskeleton; GO:0005515 protein binding; GO:0005525 GTP binding; GO:0019904 protein domain specific binding; GO:0031625 ubiquitin protein ligase binding; GO:0032794 GTPase activating protein binding; GO:0042288 MHC class I protein binding; GO:0044877 protein-containing complex binding; GO:0046872 metal ion binding
  • GO BP:  GO:0000226 microtubule cytoskeleton organization; GO:0000278 mitotic cell cycle; GO:0007017 microtubule-based process; GO:0008150 biological_process; GO:0050807 regulation of synapse organization; GO:0051225 spindle assembly; GO:0071895 odontoblast differentiation
  • GO CC:  GO:0005634 nucleus; GO:0005641 nuclear envelope lumen; GO:0005737 cytoplasm; GO:0005856 cytoskeleton; GO:0005874 microtubule; GO:0015630 microtubule cytoskeleton; GO:0032991 protein-containing complex; GO:0036464 cytoplasmic ribonucleoprotein granule; GO:0044297 cell body; GO:0045121 membrane raft; GO:0045171 intercellular bridge; GO:0072686 mitotic spindle

Sequence Information

  • Sequence:  SVVPSPKVSDTVVEPYNA
  • Length:  18(168-185)
  • Propeptide:  MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV
  • Signal peptide:  NA
  • Modification:  T5 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P69897-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002776_AF2.pdbhor002776_ESM.pdb

Physical Information

Mass: 219149 Formula: C84H134N20O29
Absent amino acids: CFGHILMQRW Common amino acids: V
pI: 4.18 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 6
Hydrophobicity: -4.44 Boman Index: -1862
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.11
Instability Index: 5288.89 Extinction Coefficient cystines: 1490
Absorbance 280nm: 87.65

Literature

  • PubMed ID:  23410195
  • Title:  Neurotoxin-Induced Neuropeptide Perturbations in Striatum of Neonatal Rats